PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001893m
Common NameCICLE_v10001893mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 316aa    MW: 35230.3 Da    PI: 8.409
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001893mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.48.7e-15248290547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+k
  Ciclev10001893m 248 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLRK 290
                      79***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-13244308IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.76246291IPR004827Basic-leucine zipper domain
PfamPF001709.2E-13248291IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-12248291No hitNo description
CDDcd147073.37E-24248293No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-14248291No hitNo description
PROSITE patternPS000360251266IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MLMKGMQMMG SQGDGSSNGK QSQFQPLARQ NSMYSLTLDE VQNQLGDLGK PLSSMNLDEL  60
LKNVWTAEVE MEGTTLADQT SLQRQASLSL TSALSKKTVD EVWRDIQQSK NSGEKKPRDR  120
QPTLGEMTLE DFLVKAGVVA EASSDKKSDG PVVGVDQNVV PQFPQQGPWM PYPHPQYQHS  180
QQSMMGVYMP GQPIPQPMNM VTGAVMDVSF PENQVGLTSP SMGTLSDPQL LGRKRGASED  240
MIEKTVERRQ KRMIKNRESA ARSRARKQAY TNELENKVSR LEEENERLRK QKVGFLILFM  300
LFCIAVADLV VLLFK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432530.10.0hypothetical protein CICLE_v10001893mg
SwissprotQ9LES39e-83AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4T3260.0V4T326_9R
STRINGPOPTR_0008s01130.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-72ABA-responsive element binding protein 3